SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019687 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019687
Domain Number 1 Region: 99-154
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000157
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019687   Gene: ENSMMUG00000015019   Transcript: ENSMMUT00000021057
Sequence length 358
Comment pep:known chromosome:MMUL_1:14:12982167:12990769:1 gene:ENSMMUG00000015019 transcript:ENSMMUT00000021057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGRMETLKEKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAEQNLEFQ
GPLEISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEA
MAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPP
PARPVPQATPPVVEEQPQPPSAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFY
SGPLGPTYPAAQPGPRGAVGYSWSPQRSTPPRSGYPGTPTGTSGPGYPLAGGRAPSPGYP
QQSPYPATGGKPPYPIQPQLHSFPGQPQPSLPPQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences ENSMMUP00000019687 ENSMMUP00000019687 9544.ENSMMUP00000019687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]