SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019717 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019717
Domain Number 1 Region: 940-1221
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.55e-71
Family Complement components 0.0001
Further Details:      
 
Domain Number 2 Region: 762-881
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000196
Family SVA-like 0.034
Further Details:      
 
Domain Number 3 Region: 1303-1367
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000222
Family Alpha-macroglobulin receptor domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019717   Gene: ENSMMUG00000002144   Transcript: ENSMMUT00000021087
Sequence length 1386
Comment pep:known chromosome:MMUL_1:11:9715842:9760054:-1 gene:ENSMMUG00000002144 transcript:ENSMMUT00000021087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYILWVSSVIQSDSAGKACLHLLKLNESVSLSVVLEYDGSNTTIFDQFVEEDNFYACADF
KVSQKSSEQLAIITLLAKGDTHQISERRSVAVISEEKATFIQTDKPIYKSGENVLDLINT
FFQENYVYLLPYGTLWDPQNNRIFQWQNVTSFRNITQLSFQLISEPIFGDYWIVVKKNSG
KTVTHQFAVKRYVLPKFEVTVSAPQIVTISDDEFQVDVCAKYTFGQPVQGKTQIRVCREY
FSSSNCEKNDNEICEQFIAQVKTTIFTPKQKFSLIFHSYSFFDFIYKRGFTILNYFIWSV
QIGEETSVFITQLLGTVNFENMDTFYRRGISYFGTLKFSGPNNVPMVNKLLQLELNDEFI
GNYTTDENGEAQFSIDTSDIFDPEFNLKATYVRPKSCYLPSWLTPQYSDASFLVSRFYSR
TNSFLKIVPEPKQLECNQQKVVTVLYSLNSEAYEDGSNVKFFYLVSLSHDPGNSRHFICS
SPIYTAWNGNFSFPISISADLAPVAVLFVYTLHPSGEIVADSVRFQIDKCFKHKVNIKFS
KEQGLPGSNASLYLQAAPDSFCALRAVDRSVLLLKSEQQLSAESVYNKVPSIELYGYFYR
GLNLDDGKEDPCIPQREMFYNGLYYMPVSNYGDGDIYNIVMNMGLKVFTNLHYRKPEVCV
MERGRSLSKPLYVGTENYGLMLSAPSRIACREENADYVEQAIIQTVRTNFPETWIWDLVS
VDSSGSANLSFLIPDTITQWEASGFCVNGDVGFGVSSTATLEVSQPFFVEIASPFSVVQN
EQFDLIVNVFNYLDTCVEISVQVEESQNYEANINTLKINGSEIIQTGGRKTNVWTIIPKK
LGKVNITVAAESKQSSACPNKGMEQQKLSWKDTVVKSFLVEPEGIEKERTQSFLICTEGA
RASKQGVLDLPNDVVEGSARGFFTVVGDILGLAMQNLVVLQTPYGSGEQNAALLASDTYV
LDYLKSTEQLTEEVQSKALFLLSNGYQRQLSFKNSDGSYSVFWQQNQKGSIWLSALTYQT
LERMKNYVFIDENVQKQTLIWLSSQQKTNGCFKNDGQLFNHAWEGGDEEDISLTAYVVGM
FFEAGLNFTFPALRSALFCLEEALDSGVTNGYNHAILAYTFALAGEEQKVESLLQTLDQS
ATKINNVIYWERERKPKTEEFPSFIPWAPSAETEKTCYVLLAVVSRKTPDLTYASKIVQW
LAQQMDSHGGFSSTQVIHVGLILIAVCLKWGLTFSKDENTVTFSREGSSEIFQVNSDNRL
LVQRSELTKAPGEYTVDVEGHGCTFIQATLKYNVLLPKKASGFSLSLEIVKNSSDIFQTI
FDLTVTLKYTGIHNKSSIVVTDVKMLSGFTPAMSSIEEVNNRSLICQHKDSYIEYKDKIN
TCLAVV
Download sequence
Identical sequences ENSMMUP00000019717 ENSMMUP00000019717 9544.ENSMMUP00000019717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]