SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019796 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019796
Domain Number 1 Region: 260-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-55
Family Voltage-gated potassium channels 0.00092
Further Details:      
 
Domain Number 2 Region: 99-210
Classification Level Classification E-value
Superfamily POZ domain 8.11e-26
Family Tetramerization domain of potassium channels 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019796   Gene: ENSMMUG00000015105   Transcript: ENSMMUT00000021170
Sequence length 545
Comment pep:known_by_projection chromosome:MMUL_1:15:74512758:74524484:-1 gene:ENSMMUG00000015105 transcript:ENSMMUT00000021170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQSERRRSWSYKPWNTTENEGSQPRRSICSLGARSGSQASIQGWIEGNYNYYIEEDED
GEEEDQCKDDLAEEDQRAEELTTAKPEGPSDLPALLSTLNVNVGGHSYQLDYCELVSFPK
TRLGRLATSTSRSRQLSLCDDYEEQTDEYFFDRDPAVFQLVYNFYLSGVLLVLDELCPRC
FLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQRELRAQAQVEEAEELFRDMRFYG
PQRRRLWNLMEKPFSSVAAKAIGVASSIFVLVSVVALVLNTVEEMQQHSEQDDGGPDLRS
ILEHVEMLCIGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQLLLECFTGENH
QRGQTVGSVGKVGQVLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAM
GIFTFSAAVYSVEHDVPSTNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAF
GIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGEVNFMQRARKKIAECLVGSNPQPT
PRQEN
Download sequence
Identical sequences F6WNK5
ENSMMUP00000019796 XP_001086960.1.72884 9544.ENSMMUP00000019796 ENSMMUP00000019796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]