SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019858 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019858
Domain Number 1 Region: 31-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000158
Family Complement control module/SCR domain 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019858   Gene: ENSMMUG00000015149   Transcript: ENSMMUT00000021237
Sequence length 266
Comment pep:known chromosome:MMUL_1:9:6217379:6253077:-1 gene:ENSMMUG00000015149 transcript:ENSMMUT00000021237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRARGSRTLGLPALLLLLLLRPPATRGITCPPPVSVEHADIRVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNIAHWTTPSLKCIRDPLLARQRPALPFTVTTAGVTPQPE
SLSPSGKEPAASSPSSNTTAATTAAIVPSSRLMPSTSSSTGTTEIGSHESSHGPSQTTAK
TWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYIKSRQTPPPASIEM
EAMEALPVTGETSSRDEDLENCSHDL
Download sequence
Identical sequences 9544.ENSMMUP00000019858 ENSMMUP00000019858 ENSMMUP00000019858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]