SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019861 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019861
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019861   Gene: ENSMMUG00000015151   Transcript: ENSMMUT00000021240
Sequence length 175
Comment pep:known chromosome:MMUL_1:9:6300595:6308420:-1 gene:ENSMMUG00000015151 transcript:ENSMMUT00000021240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKSGSPYMLCTGNSSHSSWDN
QCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVSLPGEEEPQASPDGLPESE
TSRLVTTTDFRIQTEVAATMETFIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQ
Download sequence
Identical sequences ENSMMUP00000019861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]