SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019977 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019977
Domain Number 1 Region: 41-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.56e-118
Family L-arabinose binding protein-like 0.0000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019977   Gene: ENSMMUG00000015240   Transcript: ENSMMUT00000021363
Sequence length 910
Comment pep:known_by_projection chromosome:MMUL_1:3:163980505:164795502:-1 gene:ENSMMUG00000015240 transcript:ENSMMUT00000021363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRTSIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGNAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKARVEHMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHC
ERCEGYNYQVDELSCELCPLDQRPNINRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIAT
TFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLG
MCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDP
PHIIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFN
EAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKV
YIIIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKT
TYISYSNHSI
Download sequence
Identical sequences ENSMMUP00000019977 ENSMMUP00000019977 9544.ENSMMUP00000019977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]