SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019994 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019994
Domain Number 1 Region: 38-201
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-41
Family C-type lectin domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019994   Gene: ENSMMUG00000015250   Transcript: ENSMMUT00000021380
Sequence length 204
Comment pep:known chromosome:MMUL_1:11:8497169:8510751:1 gene:ENSMMUG00000015250 transcript:ENSMMUT00000021380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEITYAEVRFQNESKFSGIDSASSAASKKRTAPHKSNTGFSKLLCASLMILFLLLAIS
FFFAFFKTAWSCCPKNWKPFSSNCYFISTESASWQKSEKDCARMEAHLLVINTREEQDFI
FQNLQEESAYFVGLSDPEGQRHWQWVDRTPYNESSTFWHPHEPSDPNERCVVLNFRKTPK
RWGWNDVHCIVHQRSVCEMMKIHL
Download sequence
Identical sequences F6VNJ5
ENSMMUP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]