SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020060 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020060
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-35
Family C-type lectin domain 0.000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020060   Gene: ENSMMUG00000015297   Transcript: ENSMMUT00000021448
Sequence length 200
Comment pep:known chromosome:MMUL_1:11:9969410:9976150:-1 gene:ENSMMUG00000015297 transcript:ENSMMUT00000021448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDHCYVTENSSLHPESGQENDATSPRFSTHREGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSDDWVSYQRKCYFISTVKRSWTSAQSACSEHGATL
AVIDSVKDMNFLKRYAGGDEHWVGLKKEPGHPWKWSNGKEFNNWFNLTGSEKCAFLKNTE
VSSMECEKNLYWICNKPYKS
Download sequence
Identical sequences A0A2K6CQG8 F6QEG7 G7PJS2
XP_005570146.1.63531 XP_011771076.1.29376 XP_015006545.1.72884 9544.ENSMMUP00000020060 ENSMMUP00000020060 ENSMMUP00000020060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]