SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020063 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020063
Domain Number 1 Region: 55-181
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-35
Family C-type lectin domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020063   Gene: ENSMMUG00000015299   Transcript: ENSMMUT00000021451
Sequence length 181
Comment pep:known chromosome:MMUL_1:11:10026854:10041995:1 gene:ENSMMUG00000015299 transcript:ENSMMUT00000021451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEERYMTLNVQSKKRTSTQTTQLTFKDYSVVLHWYKILLGISGTLNGILALALISLIL
LVLCQSEWLKYRGKCYWFSNEMKSWSDSYVYCLERKSHLLIIQDELEMAFIQKNLRQSNY
VWMGLNFTSLKMTWTWVDGSPLDPKIFFIKGPAKENSCAAIKESKIYSETCSSVFKWICQ
Y
Download sequence
Identical sequences A0A2K5UF86 A0A2K6B6K3 F6QEC3
ENSMMUP00000020063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]