SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020068 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020068
Domain Number 1 Region: 15-150
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-33
Family C-type lectin domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020068   Gene: ENSMMUG00000015304   Transcript: ENSMMUT00000021456
Sequence length 151
Comment pep:known chromosome:MMUL_1:11:10050874:10060340:-1 gene:ENSMMUG00000015304 transcript:ENSMMUT00000021456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKHKKCFIVGAALIIITNIIAVYVVKLTQDSQSFCPYGWIGFQNKCYYFSKEEGDWNS
SKYNCSTQHADLTIIDNTEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGAIFTKSFGMR
GSEGCAYLSDDGAATARCYTERKWICRKKIH
Download sequence
Identical sequences A0A2K6BDT6 F6QE56 G7PJS4
ENSMMUP00000020068 9544.ENSMMUP00000020068 NP_001245034.1.72884 XP_005570152.1.63531 XP_011771085.1.29376 ENSMMUP00000020068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]