SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020069 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020069
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-23
Family C-type lectin domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020069   Gene: ENSMMUG00000015305   Transcript: ENSMMUT00000021457
Sequence length 136
Comment pep:known_by_projection chromosome:MMUL_1:11:10103210:10122950:-1 gene:ENSMMUG00000015305 transcript:ENSMMUT00000021457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINPELRDGRPDGFRRRTICNFKPNWKICLCVCFVIIFAACIIMIVKWPKCDKRVACSGD
WLAVREKCFYFSDDTRNWTASKIFCSLQKSELAQIDTQKDTEFLKRYAGTDMHWIGLSRK
QGDSWKWTNGTTFNDW
Download sequence
Identical sequences 9544.ENSMMUP00000020069 ENSMMUP00000020069 ENSMMUP00000020069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]