SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020087 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020087
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-37
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020087   Gene: ENSMMUG00000015320   Transcript: ENSMMUT00000021478
Sequence length 766
Comment pep:known chromosome:MMUL_1:4:69237743:69438825:1 gene:ENSMMUG00000015320 transcript:ENSMMUT00000021478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIF
ATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYL
VEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGIL
GSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPT
KKEQGEASSSQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWS
FNDRTRFRPSLRLKSSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIR
IMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKS
REKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQI
PPFECEQTSDYQSPVDSKDLSGSTQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALS
PTMHSQATQVPMSQSDGSAVAATNTVANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETL
HPNPAGLQESISDVTTCLVASKENVQVAQSNLAKDRSMRKSFDMGGETLLSVCPMVPKDL
GKSLSVQNLIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTF
DAAPQPAREAAFASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Download sequence
Identical sequences A0A0D9RN61 A0A1D5QK96 A0A2K5L661 A0A2K5W4W8 A0A2K6DCU0
ENSMMUP00000020087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]