SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020105 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020105
Domain Number 1 Region: 241-489
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-86
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-20
Family Hepsin, N-terminal domain 0.087
Further Details:      
 
Domain Number 3 Region: 111-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020105
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00732
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020105   Gene: ENSMMUG00000015332   Transcript: ENSMMUT00000021496
Sequence length 492
Comment pep:known_by_projection chromosome:MMUL_1:3:5142042:5181933:1 gene:ENSMMUG00000015332 transcript:ENSMMUT00000021496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNSGSPPGVGPYYENHGYQPENPYPAQPTVAPNVYEVHPAQYYPSPVPQYTPRVLTHA
SNPAVCRQPKSPSGTVCTSKTKKALCVTMTLGAVLVGAALAAGLLWKFMGSKCSDSGIEC
DSSGTCISSSNWCDGVSHCPNGEDENRCVRLYGPNFILQVYSSQRKSWHPVCRDDWNENY
ARAACRDMGYKNSFYSSQGIVDNSGATSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVRSNLSRQSRIVGGQNALLGAWPWQVSLHVQNIHVCGGSIITPEWIVTAAHCVEK
PLNSPWQWTAFVGTLRQSSMFYEKGHRVEKVISHPNYDSKTKNNDIALMKLHTPLTFNEV
VKPVCLPNPGMMLEPEQHCWISGWGATQEKGKTSDVLNAAMVPLIEPRRCNNKYVYDGLI
TPAMICAGFLRGTVDSCQGDSGGPLVTLKNDVWWLIGDTSWGSGCAQANRPGVYGNVTVF
TDWIYRQMRADD
Download sequence
Identical sequences ENSMMUP00000020105 ENSMMUP00000020105 9544.ENSMMUP00000020105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]