SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020296 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020296
Domain Number 1 Region: 131-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000341
Family I set domains 0.054
Further Details:      
 
Domain Number 2 Region: 28-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000428
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020296   Gene: ENSMMUG00000015470   Transcript: ENSMMUT00000021697
Sequence length 272
Comment pep:known_by_projection chromosome:MMUL_1:1:139196984:139234159:-1 gene:ENSMMUG00000015470 transcript:ENSMMUT00000021697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSV
AYVTPGDSEMAPKVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTT
TKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLRIRHTGLLSVLAMFFLLVVIL
SSVFLFRLLKRRQGASLQGRASEFSLFRSAVR
Download sequence
Identical sequences F6QA42
ENSMMUP00000020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]