SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020327 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020327
Domain Number 1 Region: 344-620
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-71
Family Protein kinases, catalytic subunit 0.00000244
Further Details:      
 
Domain Number 2 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 3 Region: 102-166
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000141
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020327   Gene: ENSMMUG00000030204   Transcript: ENSMMUT00000021730
Sequence length 651
Comment pep:novel chromosome:MMUL_1:6:14671006:14692509:1 gene:ENSMMUG00000030204 transcript:ENSMMUT00000021730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKWGERICPLGTLYVTVLLWKTDCSGAPGEAALQCRLGPVPAACWALASFGPSLMLPSQ
AQGLLWWVFPLFPASSLPYPPVSYRADGLARNTFLKACSESSSSSNISTMLVTHDYTAVK
EDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTL
KKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPE
FVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEATLKI
VGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVAELGRGR
FSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQSLQHPLLVGLLDTFETPTSYV
LVLEMADQGRLLDCVVRWGSLTEGKIRAHLGEVLEAVRYLHNCRIAHLDLKPENILVDES
LAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLL
SGVSPFLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQ
EQWLQAGNGRSTGVLDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences G7MUN7
ENSMMUP00000020327 9544.ENSMMUP00000020327 ENSMMUP00000020327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]