SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020367 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020367
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-23
Family V set domains (antibody variable domain-like) 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020367   Gene: ENSMMUG00000015525   Transcript: ENSMMUT00000021773
Sequence length 117
Comment pep:known chromosome:MMUL_1:7:84564285:84564755:1 gene:ENSMMUG00000015525 transcript:ENSMMUT00000021773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLVLVLEVIFTLGGTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPYLFWYVQYPN
QGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVNDTVP
Download sequence
Identical sequences ENSMMUP00000020367 9544.ENSMMUP00000020367 ENSMMUP00000020367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]