SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020374 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020374
Domain Number 1 Region: 15-101
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000824
Family DPP6 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020374   Gene: ENSMMUG00000015529   Transcript: ENSMMUT00000021780
Sequence length 151
Comment pep:known_by_projection chromosome:MMUL_1:3:40330380:40333258:1 gene:ENSMMUG00000015529 transcript:ENSMMUT00000021780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQHLSGVGCQEVRVSVKPDGPVCLCSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTG
RYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKD
LKKYSKIFEQKDRLSQSKASKVSLVPQRAVL
Download sequence
Identical sequences ENSMMUP00000020374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]