SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020532 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020532
Domain Number 1 Region: 139-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000522
Further Details:      
 
Domain Number 2 Region: 37-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.3e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000597
Further Details:      
 
Domain Number 3 Region: 340-490
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000565
Family N-terminal domain of adrenodoxin reductase-like 0.000000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020532   Gene: ENSMMUG00000015648   Transcript: ENSMMUT00000021953
Sequence length 491
Comment pep:known_by_projection chromosome:MMUL_1:16:70136535:70147045:-1 gene:ENSMMUG00000015648 transcript:ENSMMUT00000021953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRPPPAGSTPSFRHHLSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENRELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPADFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPEEAARWASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVGEATRAVPTGDMEDLPCGLVLSSV
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSNWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH
Download sequence
Identical sequences ENSMMUP00000020532 9544.ENSMMUP00000020532 ENSMMUP00000020532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]