SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020544 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020544
Domain Number 1 Region: 245-389
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-41
Family Mannose 6-phosphate receptor domain 0.00000069
Further Details:      
 
Domain Number 2 Region: 549-684
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-39
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 3 Region: 1440-1571
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-36
Family Mannose 6-phosphate receptor domain 0.000000115
Further Details:      
 
Domain Number 4 Region: 1290-1431
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-36
Family Mannose 6-phosphate receptor domain 0.00062
Further Details:      
 
Domain Number 5 Region: 685-846
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.68e-34
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 6 Region: 402-540
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.14e-31
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1147-1287
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-31
Family Mannose 6-phosphate receptor domain 0.00015
Further Details:      
 
Domain Number 8 Region: 1576-1721
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 9 Region: 2057-2204
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 10 Region: 991-1143
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-29
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1911-2050
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.88e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 128-241
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.03e-28
Family Mannose 6-phosphate receptor domain 0.00000177
Further Details:      
 
Domain Number 13 Region: 1728-1821,1870-1913
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.33e-21
Family Mannose 6-phosphate receptor domain 0.0029
Further Details:      
 
Domain Number 14 Region: 856-1000
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.5e-21
Family Mannose 6-phosphate receptor domain 0.004
Further Details:      
 
Domain Number 15 Region: 1820-1869
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-16
Family Fibronectin type II module 0.0012
Further Details:      
 
Domain Number 16 Region: 19-88
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000144
Family Mannose 6-phosphate receptor domain 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020544   Gene: ENSMMUG00000015658   Transcript: ENSMMUT00000021965
Sequence length 2416
Comment pep:known_by_projection chromosome:MMUL_1:4:157004651:157097163:1 gene:ENSMMUG00000015658 transcript:ENSMMUT00000021965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDKQRCGHCLFTLFFLQIGDSVLRSATRSLLEFNTTVSCDRPGTNHRVQSSIAFLCGKTL
GTPEFVTATECVHYFEWRTTAACKKDIFKAKKEVTRFCFISRLKMHEKRLLLGTGLAFLA
CSQRWDTELLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGDQAFNVGQPQEGLKLVRK
DRLVLSYVREEAGELDFCDGHSPAVTITFVCPSERREGTIPKLTAKSNCRYEVEWITEYA
CHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSPYISDGKEYLFYLNVCGETETQFCNKK
QAAVCQVKRNNTSQVKAAGRYQNQTLRYSDGDLTLIYFGGDECSSGFQRMSVINFECNKT
AGKDGKGNPVFTGEVDCTYFFTWDTKYACVKEKEDLLCGAVDGKKRYDLSALVRHAEPEQ
NWEAVDGSQTETEKKHFFINICHRVLQAGKARGCPEDAAVCTVDKNGSKNLGKFISSPTK
EKGNIQLSYSDGDDCGHGKKIRTNITLVCKPGDLESAPVLRTSGEGGCFYEFEWHTAAAC
VLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFYINVCGPVSVSPCQPDSG
ACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERHTPRATLITFLCDRDAGV
GFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDLSSLAKSEGGPGGNWYAM
DNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGSFTEVVSISNLGMAKTGP
TIEDSGSLLLEYVNGSTCTTSDGRQTTYTTRIHLVCSRGRLNSHPIFSLNWECVVTFLWN
TEAACPIQTATDTDQACSIKDPNSGFVFNLNPLNSSQGYVFFNIGKTFVFNVCGTMPVCG
TIQGKPASGCEAETHTEDLQNLKPERAVGIEKSLQLSTEGFITLTYKGPVSAKGSADAFI
IRFVCNDGVYPAISRFLHQDIDSGQGIRNTYFEIETALACVPSPVDCQVTVSDLAGNEYD
LSGLSIVRKPWTAVDTSVDGRKRTFYLSVCSPLPDIPGCHGSAMGSCLVSEVNNWNLGVV
QMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPTFQLQDGCEYVFIWRTVE
ACPIVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDK
SRVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDR
STQQPVFLKETSDCSYLFEWRTQYACPPFDVTECSFKDGTGNSFDLSSLSRYSENWEAIT
ATGDPEHYLINVCKSLAPHGGTEPCPPEAAACLLGSSKPVNLGRVRDGPQWRDGVIVLKY
VDGDLCPDGIRKKSTTIRFTCNENQVNSRPMFISAVEDCEYTFAWPTATACPVQNNEHDD
CQVTNPSTGHLFDLTSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVG
KASKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCT
LFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESEDDASDTNPDFYINIC
QPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPVANEIYLNFESSTPCLADKH
FNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVRTEGCALTDEQLLYSF
NLSSLSTSTFKVTRDSRTYSVGVCTAAAGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLD
YRHQDEAVVLSYVNGDRCPPETDEGIPCVFPFTFNGKSYEECVIESRAKLWCSTTADYDR
DHEWGFCRHSNSHRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKMECK
FIQKHKTYDLRLLSSLTGSWSLVHDGVSYYINLCQRIYKGPLGCSERASICRRSTTGDVQ
VLGLVHTQKLDVIGDKVVVTYSRGYPCGGNKTASSVIELTCTKTVGRPAFKRFDIDSCTY
YFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEI
QLSSITSSRNPACSGANICQVKPDDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKD
KTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDNENPGDDEQV
HKGLSERSQAVGTVLSLLLVALTGCLLALLLYKKERRETVISKLTTCCRRSSNVSYKYSK
VNKEEETDENETEWLMEEIQLPSPRQGKEGQENGHITTKSVKALSSLHGDDQDSEDEVLT
IPEVKVHSGRGAGAESSHPLRNPQSSALQEREDDRAGLVRGEKARKGKFRSAQQKTVSST
KLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSMMUP00000020544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]