SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020617 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020617
Domain Number 1 Region: 41-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000247
Family Protein kinases, catalytic subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020617   Gene: ENSMMUG00000015702   Transcript: ENSMMUT00000022039
Sequence length 199
Comment pep:known_by_projection chromosome:MMUL_1:18:67929218:67933974:-1 gene:ENSMMUG00000015702 transcript:ENSMMUT00000022039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGEVKSALGLELSNSSLGPWWPGRRGPRWRGQLASLWALLQQEEYVYFSLLQDLSPHV
LPVLGSCGHFYAVEFLAAGSPHHRALFPLDRVPGAPGGGQARAISDIALSFLDMVNHFDS
DFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTDDEDCNFFDCFSR
CDLRVNKCGAQRVNNNLQV
Download sequence
Identical sequences ENSMMUP00000020617 ENSMMUP00000020617 9544.ENSMMUP00000020617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]