SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020623 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020623
Domain Number 1 Region: 565-699,775-946
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.14e-77
Family Protein kinases, catalytic subunit 0.0000000112
Further Details:      
 
Domain Number 2 Region: 223-254,283-290,337-408
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000526
Family I set domains 0.075
Further Details:      
 
Domain Number 3 Region: 117-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000101
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 34-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000106
Family C1 set domains (antibody constant domain-like) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020623   Gene: ENSMMUG00000015707   Transcript: ENSMMUT00000022045
Sequence length 1088
Comment pep:known_by_projection chromosome:MMUL_1:5:75100325:75162126:-1 gene:ENSMMUG00000015707 transcript:ENSMMUT00000022045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWKNNLTLIENLT
EITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDLV
DDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRDR
STVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIIS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSYV
ILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNL
LSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSESEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
Download sequence
Identical sequences 9544.ENSMMUP00000020623 ENSMMUP00000020623 ENSMMUP00000020623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]