SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020717 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020717
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.14e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020717   Gene: ENSMMUG00000015774   Transcript: ENSMMUT00000022144
Sequence length 178
Comment pep:known_by_projection chromosome:MMUL_1:9:101416349:101418432:-1 gene:ENSMMUG00000015774 transcript:ENSMMUT00000022144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGTAAALAFLSQESRTRAGGVGGLRVSAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEAELCPILPAKKQGGRP
Download sequence
Identical sequences F6QIT0
ENSMMUP00000020717 9544.ENSMMUP00000020717 ENSMMUP00000020717 NP_001181431.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]