SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020738 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020738
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.14e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020738
Domain Number - Region: 208-290
Classification Level Classification E-value
Superfamily HRDC-like 0.0288
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020738   Gene: ENSMMUG00000015781   Transcript: ENSMMUT00000022165
Sequence length 294
Comment pep:known chromosome:MMUL_1:6:167770496:167792402:1 gene:ENSMMUG00000015781 transcript:ENSMMUT00000022165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLADLKYDCIDDELDDNENAKRCR
FVDYSMQEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPTSYGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences ENSMMUP00000020738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]