SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020747 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020747
Domain Number 1 Region: 29-160
Classification Level Classification E-value
Superfamily C-type lectin-like 8.12e-38
Family Link domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020747   Gene: ENSMMUG00000015790   Transcript: ENSMMUT00000022177
Sequence length 321
Comment pep:known_by_projection chromosome:MMUL_1:14:61379727:61394945:1 gene:ENSMMUG00000015790 transcript:ENSMMUT00000022177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCFRLVLLLASIWTTRLLVQGSLHAEELSIQVSCRIMGITLVSKKANPQLNFTEAKEA
CRLLGLTLASKDQVETAWKASFETCSYGWIGDGFVVISRISPNPKCGKNGVGVLIWKVAV
NRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATPTTEFIVSDSTYSVASPYSIAPA
PTTTPAPASTSIPRRKKLICITEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALL
VLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKADDINPNEESKKTD
NNPEEPKSPSKTTVRCLEAEV
Download sequence
Identical sequences XP_001100103.1.72884 ENSMMUP00000020747 9544.ENSMMUP00000020747 ENSMMUP00000020747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]