SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020800 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020800
Domain Number 1 Region: 1525-1773
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-36
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 1205-1360,1399-1433
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.69e-31
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 718-865,897-944
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 132-276,352-421
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020800   Gene: ENSMMUG00000015825   Transcript: ENSMMUT00000022231
Sequence length 2013
Comment pep:known_by_projection chromosome:MMUL_1:2:97884184:97985534:1 gene:ENSMMUG00000015825 transcript:ENSMMUT00000022231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLRESREGLPEEEAPRPQLDLQA
SKKLPDLYGNPPRELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSYPLHMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILAR
GFCLHAFTFLRDPWNWLDFSVIVMAYVSENIKLGNLSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGL
VWESLDLYLSDPVGSTEEAITSSSVNCGSASLNQTCPEGYRCLKAGENPDHGYTSFDSFA
WAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQ
NQATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVNSHERRSKRR
KRMSSGTEECGEDRLPKSDSEDGPRAMNHLSLTHGLSRTSVKPRSSRGSIFTFRRRDLGS
ETDFADDENSTAGDSESHHTSLLVPWPLRRTSAQGQPSPGTSTPGHALNGKKNSTVDCNG
VVSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGGPQMLTPQVPCIDGFEEPGAR
QRALSAVSVLTSALEELEESRRKCPPCWNRLAQRYLIWECCPLWMSIKQGVKLVVMDPFA
DLTITMCIVLNTLFMALEHYNMTSEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQ
GWNIFDSIIVILSLMELGLSRMSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGAL
GNLTLVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEW
IETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDREMNNL
QLALARIQRGLRFVKRTTWDFCCGLLRQRPQKPAALAAQGQLPSCIATPYSAPPPETEKV
PPTRKETRFEEGEQPGQGTPRDPEPVCVPIAVAESDTDDQEEDEENSLDTEEESSKQQES
QPVSAGPEAPPDRTWSQVSATASSEAEASVSQADWQQQQRKEEPQAPGCGETQEDSGSEG
STADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTSQAPGKVWWRLRKTCY
HIVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWV
AYGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVN
NKSQCESLNMTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYAKDAQ
GRKNLPLKIHHGTNGFNLQEFFLCTLCGSVAGVLGSLEGRVGGWVAWDERQKRAFASLPR
ALLSAFHLPLQNKYQGFVFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKINILAKI
NLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPTLFR
VIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVK
WEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGDCG
SPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDP
EATQFIEYSVLSDFADALSEPLRIAKPNQMSLINMDLPMVSGDRIHCMDILFAFTKRVLG
ESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSVKH
ASFLFRQQTGSSLSEEDAPEREGLIANVMNENFSRPFGPPSSSSISSTSFPPSYDSVTRA
TSDNIQVPGSDYSHSEDVADFPPSPDRDRESIV
Download sequence
Identical sequences 9544.ENSMMUP00000020800 ENSMMUP00000020802 ENSMMUP00000020800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]