SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020846 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020846
Domain Number 1 Region: 50-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-19
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020846   Gene: ENSMMUG00000015856   Transcript: ENSMMUT00000022281
Sequence length 409
Comment pep:known_by_projection chromosome:MMUL_1:17:81479414:81755915:-1 gene:ENSMMUG00000015856 transcript:ENSMMUT00000022281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSRSSTTSTATTQMFHEDAAGGWQLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMV
TVDVIVAASNYYKGENFRRQYDEFYLAEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFE
LLLVIGTTLHVYPDLYHSQFTYFQVLRVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTA
SLLIVMSAISLQMFCFVEELDRFTTFPRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPV
VAIYFILYHLFATLILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLRLRIF
EKFPNRPQMVKISKLPSDFTVPKIRESFMKQFIDRQQQDTCCLLRSLPSTSSSSCDHSKR
SAIEDNKYIDQKVSSAVSNNQASKKHVCLRKELQSSLGSWNPISLENNF
Download sequence
Identical sequences ENSMMUP00000020846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]