SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020852 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020852
Domain Number 1 Region: 886-1043,1095-1162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-25
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 385-604
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 36-203,259-328
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000033
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 1212-1449
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000228
Family Voltage-gated potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020852   Gene: ENSMMUG00000015856   Transcript: ENSMMUT00000022287
Sequence length 1734
Comment pep:known_by_projection chromosome:MMUL_1:17:81388684:81755915:-1 gene:ENSMMUG00000015856 transcript:ENSMMUT00000022287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNYVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDAAGGW
QLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFY
LAEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQV
LRVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTT
FPRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVIL
DNLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIR
ESFMKQFIDRQQQDTCCLLRSLPSTSSSSCDHSKRSAIEDNKYIDQKLRKSVFSIRARNL
LEKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRG
KSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFI
VGREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICS
CISMMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDI
FIYLVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFL
VSILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGE
KKPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVF
VFLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGF
RAKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMK
IIAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHV
STLKIIFNEFVCFHDSSFFLRQSVLLCHQAGVQVGNQIYYNLHLFWHANFSSAGKAITVL
FRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLL
VAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGRLE
VDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYSVDIRSLQLEELLAREQLEYTIE
EEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPSEDTN
ANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHSVS
SVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI
Download sequence
Identical sequences ENSMMUP00000020852 9544.ENSMMUP00000020852 ENSMMUP00000020846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]