SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020945 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020945
Domain Number 1 Region: 75-296
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.64e-33
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020945   Gene: ENSMMUG00000015918   Transcript: ENSMMUT00000022386
Sequence length 859
Comment pep:known_by_projection chromosome:MMUL_1:10:885307:951428:1 gene:ENSMMUG00000015918 transcript:ENSMMUT00000022386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQ
NFLYNVLERPRGWAFIHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGV
EYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRS
LRFLQILRMIRMDRRGGTWKLLGSVVYAHSKVSRWRVGMVVVVMVVVVVMQVTPVERVPG
SLLKDPLEWEIITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQ
EQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQL
ELLRNLKSKSGLAFRKEPPPEPSPSQKVSLKDRVFSSPRGVAAKGKGSPQAQTVRRSPSA
DQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSCPCEFVT
EDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQAGI
DMIVGPPPPSTPRHKKYPTKGPTAPPRESPQYSPRVDQIVGRGPAITDKDRTKGPAEAEL
PEDPSMMGRLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSP
EDSREHVDRHGCIVKIVRSSSSTGQKNFSAPPAAPPVQCPPSTSWQPQSHPRQGHGTSPV
GDPGSLVRIPPPPAHERSLSAYGGGNRASTEFLRQEDAPGCRPPEGTLRDSDTSISIPSV
DHEELERSFSGFSISQSKENLDALNSCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPP
RSATGEGPFGDVGWAGPRK
Download sequence
Identical sequences ENSMMUP00000020945 ENSMMUP00000020942 9544.ENSMMUP00000020945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]