SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021025 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021025
Domain Number 1 Region: 31-163
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-23
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 2 Region: 233-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021025   Gene: ENSMMUG00000015986   Transcript: ENSMMUT00000022475
Sequence length 757
Comment pep:known_by_projection chromosome:MMUL_1:14:8134784:8137343:1 gene:ENSMMUG00000015986 transcript:ENSMMUT00000022475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAAGPTLGQDPWAAEPRSACGPSSCYALFPRRRTFLEAWRACRELGGDLAT
PRTPEEAQRVDNLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQP
ATGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYT
TPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNG
GCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF
RPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGARA
SQDLGDELLDDGEDEEDEDEAWEAFGGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREP
QIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATRPTLPSTHQPPVIPATHPALSRDH
QIPVIAANYPDLPSAYQPGILSVSHPAQPPAHQPPMISTRYPELFPAHQSPMFPDTQVAG
TQPTTHLPAIPPNRAPLVTTLGAHQPPQAPDAPVLRTQATQLPIIPTAQPSLTTSSRSPV
SPAHQVSVPAATQPPALPTLLPSQSPTNQTSPISPTHPHSKVPQIPREDGPSPKLALWLP
SAAPTAAPTALGEAGLAEHIQRDDRWLLVALLVPTCIFLVVLLALGIVYCTRCGPHAPNK
RITDCYRWVTHAGSKSPTEPMPPRGSLTGVQTCRTSV
Download sequence
Identical sequences F6XNG5
NP_001181414.1.72884 ENSMMUP00000021025 ENSMMUP00000021025 9544.ENSMMUP00000021025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]