SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021124 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021124
Domain Number 1 Region: 351-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 174-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-21
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 468-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000809
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 4-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000275
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 5 Region: 527-589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 115-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 290-354
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000054
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021124   Gene: ENSMMUG00000016052   Transcript: ENSMMUT00000022580
Sequence length 671
Comment pep:known chromosome:MMUL_1:10:70127073:70214108:1 gene:ENSMMUG00000016052 transcript:ENSMMUT00000022580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALCSVSFSNPEGYIDSSDYPPLPLNNFLECTYNVTVYTGYGVELQVKSVNLSEGELLSI
RGVDGPTLTVLANQTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPR
RPDSGDVTVMDLHSGGVAHFHCHLGYELQGAKMLTCINASKPHWSSQEPICSAPCGGTVH
NATIGRVLSPSYPGNTNGSQFCVWTIEAPEGQKLHLHFERLSLHDKDRMTVHSGQTNKSA
LLYDSLQTESVPFEGLLSEGDTIRIEFTSDQARAASTFNIRFEAFEKGHCYEPYIQNGNF
TTSDPTYNIGTIVEFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAG
VVLSPNWPEPYMEGEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQY
LGNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKT
TSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTR
LISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVLAEAAAETSLE
GGNMALAIFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYE
TGETREYEVSI
Download sequence
Identical sequences ENSMMUP00000021124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]