SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021147 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021147
Domain Number 1 Region: 679-734
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000013
Family cAMP-binding domain 0.028
Further Details:      
 
Domain Number 2 Region: 383-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000157
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021147   Gene: ENSMMUG00000016075   Transcript: ENSMMUT00000022605
Sequence length 881
Comment pep:known_by_projection chromosome:MMUL_1:2:32262137:32352419:-1 gene:ENSMMUG00000016075 transcript:ENSMMUT00000022605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARVMGIYYFPSEEVPHVLVFVCILKFLKGELLGMSGIFTLAIVGLLLNSTSFKAGVEAL
LLEFWNFLSRVAFLMVFTFFGLLIPAHTYLYVKFADIYYSLNIYFTLIVLRLVTLLLMSP
ALSRVGHEFSWRWVFTMIWSETKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLI
TLIVNRFVLPTAVTILGLRDATSTKYKSVCCTFQHFQELTKSVASVLKFDKDLANADWNM
IEKAIILENPYMLNQEETTEQQKVKCPHCNKEIDEILNNEAMELANRRLLSAQMASYQRQ
YRNEILSQSAVQVLVGAAGSFGEKKGKCMRLETIKNYSESQKTITFTRKLLLNWVYNTRK
EKVGPSKYFFFHLCHTIVFTEEFEYVGYLVILMNIFPFVISWISRLNAIYRRELKHTNYC
FLTLYVLEALLKIAAMRKDFFSHTWNLFELAITLTGILYAILTEIEAIKYIFAVTEIIVF
IKLVQFIRILRIFKLIAPKVLQIIDKRVSQQKTFWYGILKGYVQGEADVMTIIDQITSSK
QIKQILLKRVIRNMKHATKELGYLEYDHPEIAVTVKTKEEINVMLNMAREILKAFGLKGI
IHKIESAQISKLIMAKKKEMLESKSIIRPLTVEEVLYHIQWLDKNQDHINFIQLERSKPG
LGIDQMVESKEKDFLIIDTDYMLSGEIIGEINCLTNEPMKYSATCETVVETCFIPKTHLY
DAFKQCSPLIEHKMWLKIGLAITARKIREHLSYEDWNYKMQLKLSNIYIEDIPMTTKTDI
YDENVIYVILIHGAVEDCQLRKFYRAPFLIPITCHQIQGIEDFTKVVIIQTPTNMKAFRW
NIRKFIPKHKSSLTPGLMLHKNKNTFEIVKFHKNYNTSRPN
Download sequence
Identical sequences ENSMMUP00000021147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]