SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021286 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021286
Domain Number 1 Region: 456-555
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-39
Family Kringle modules 0.00000675
Further Details:      
 
Domain Number 2 Region: 791-894
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-38
Family Kringle modules 0.00000443
Further Details:      
 
Domain Number 3 Region: 675-780
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-38
Family Kringle modules 0.00000224
Further Details:      
 
Domain Number 4 Region: 905-1008
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-38
Family Kringle modules 0.00000739
Further Details:      
 
Domain Number 5 Region: 342-445
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-38
Family Kringle modules 0.0000167
Further Details:      
 
Domain Number 6 Region: 571-671
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-38
Family Kringle modules 0.00000169
Further Details:      
 
Domain Number 7 Region: 229-331
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-37
Family Kringle modules 0.00000904
Further Details:      
 
Domain Number 8 Region: 115-216
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-37
Family Kringle modules 0.00000932
Further Details:      
 
Domain Number 9 Region: 6-103
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-36
Family Kringle modules 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021286   Gene: ENSMMUG00000016201   Transcript: ENSMMUT00000022759
Sequence length 1018
Comment pep:known_by_projection chromosome:MMUL_1:4:157455631:157527197:-1 gene:ENSMMUG00000016201 transcript:ENSMMUT00000022759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPEQSHVVQDCYHGDGQSYQGTSSTTVTGRTCQAWSSMEPHQHNRTTENYPNAGLIRNY
CRNPDPVAAPYCYTMDPNVRWEYCNLTQCSDAEGTAVAPPNVTLVPSLEAPSEQSPTEQR
PGVQECYHGNGQSYRGTYFTTVTGRTCQAWSSMTPHSHSRTPENYPNGGLIRNYCRNPDP
VAAPYCYTMDPNVRWEYCNLTQCSDAEGIAVTPLTVTPVPSLEAPSKQAPTEQRPGVQEC
YHGNGQSYRGTYFTTVTGRTCQAWSSMTPHSHSRTPENYPNGGLIRNYCRNPDPVAAPYC
YTMDPSVRWEYCNLTQCSDAEGTAVAPPNVTPVPSLEAPSEQAPTEQRLGVQECYHSNGQ
SYRGTYFTTVTGRTCQAWSSMTPHSHSRTPENYPNAGLVKNYCRNPDPVAAPWCYTTDPS
VRWEYCNLTRCSDAEGTAVVPPNIIPVPSLEAFLEQEPTEETPGVQECYYHYGQSYRGTY
STTVTGRTCQAWSSMTPHQHSRTPKNYPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYC
NLTQCLVTESSVLETLTVVPDPSTQASSEEAPTEQSPEVQDCYHGDGQSYRGSFSTTVTG
RTCQSWSSMTPHWHQRTTEYYPDGGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCP
VTESSVLATSMAVSEQAPMEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWH
QRTIEYYPNGGLTKNYCRNPDAEIRPWCYTMDPRVRWEYCNLTQCVVMESSVLATPMVVP
VPSREVPSEEAPTENSPGVQDCYQGDGQSYRGTFSTTITGRTCQSWLSMTPHRHRRIPLR
YPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPVTESSVLTTPTVVPVPSTEA
PSEQAPPEKSPVVQDCYHGDGQSYRGTSSTTVTGRNCQSWSSMIPHWHQRTPENYPNAGL
TRNYCRNPDSGKQPWCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEA
Download sequence
Identical sequences ENSMMUP00000021286 9544.ENSMMUP00000021286 ENSMMUP00000021286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]