SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021296 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021296
Domain Number 1 Region: 994-1273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-68
Family Protein kinases, catalytic subunit 0.0000391
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000349
Family N-terminal PAS domain of Pas kinase 0.00000507
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021296
Domain Number - Region: 244-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000401
Family Heme-binding PAS domain 0.012
Further Details:      
 
Domain Number - Region: 347-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00384
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021296   Gene: ENSMMUG00000016207   Transcript: ENSMMUT00000022770
Sequence length 1320
Comment pep:known_by_projection chromosome:MMUL_1:12:105005808:105054756:-1 gene:ENSMMUG00000016207 transcript:ENSMMUT00000022770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRGLTAFEEDQRCLSQSLPLPVPAEGPAAQTTAEPSKSFSSAHRHPSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPAGPGGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACRLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDVISRSGEKIPVSVWMKRMRQEHRLCCVVVLEPVERVST
WVAFQSDGTITSCDGLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKHLKIQRSV
GRARDGTTFPLSLKLKSQPNSEEATPSEAAPARGYWASIWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYDSSLQLPDLASCLDVGDESGCGET
LNLWQGQDPAEGAQDPRIDVVLAGGHIVPQDETQKLVESQDIVTGTQTELGTGSQLLSCL
SPQPAPGVDSVPDGSLPVHGEQVLPKDQQVTALGREEPVAIESAGQDLLGESRSEPVDVK
PFASCEDSAAPVPAEDGGSNAGMCGLCQEARLERMGVSGPGGSDLWAGAAMAKPQAKGQL
VGGSLLMHCPCYGSEWGLWWQSQDLAPNPSGMAGLSFGTPTLDEPWLGVKNDREELQTCL
MKEQLSQLSLAGALDVPHAELVPTERPAVPAPALSCDLGGRDLYGGFTGSSSACYALATD
LPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSRCSCATSELRGTPSSLAVGSDPDV
ASLQEQGSRVLDDRELLLLTGTCVDLGQGRRFRESCLEHDPTEPLEVCLVSSEHYVASDG
ESPGHIPSVLDAGPEDTCPSAEEPRLNVQVTSTPVMPGAAGLQREIQEGAYSGSCYHRDG
LRLSVQFEVRRVELQGPTPLFCCWLVKDLLHSHLDSAARTRLFLASLPSSTHSTAAELTG
PSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTLSPLGSGAFGFVWTAVDKEKNK
EVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVQHANIIKVLDVFENQGFFQLVMEK
HGSGLDLFAFIDRHPKLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIK
LIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPF
CELEETVEAAIHPPYLVSKELMSLVSGLLQPVPEKRTTLEKLVTDPWVTQPVNLADYTWE
EVCQVNKPESGVLSAASLEMGNRSLSEVAQAQELCGGPVPGEAPNGQGCFHPGDPRVLTS
Download sequence
Identical sequences ENSMMUP00000021296 9544.ENSMMUP00000021298 ENSMMUP00000021296 ENSMMUP00000021298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]