SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021433 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021433
Domain Number 1 Region: 220-357
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-20
Family C-type lectin domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021433
Domain Number - Region: 144-220
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021433   Gene: ENSMMUG00000016318   Transcript: ENSMMUT00000022915
Sequence length 361
Comment pep:known_by_projection chromosome:MMUL_1:15:41905431:41913341:1 gene:ENSMMUG00000016318 transcript:ENSMMUT00000022915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGELTYENVQVPPVPGGPSSLASSGLG
DKAAVKSEQSTASWSAVTSLAVGRILPCRTACLRYFLLGLLLTCLLLGVAVICLGVRCEQ
SNLVFQPMNRVLEATNSSLRQQLHLKIRQLGQSAEDLQGSRRELAQSQEALEVEQRAHQA
AEGQLQACQTDNEKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCRSSDTCCPTGWTVH
QKSCFYISPTSKTWQESQKHCETLSSKLATFSEIYQQSSHSYYFILNSLLPNGGSGNSYW
TGLSSNKDEKFTDDTQYIRVYVQSSKCTKVQKGWPRYWTMEKEACGSPLPFICEMTFRFP
D
Download sequence
Identical sequences 9544.ENSMMUP00000021433 ENSMMUP00000021433 ENSMMUP00000021433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]