SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021480 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021480
Domain Number - Region: 275-334,372-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0235
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number - Region: 512-582
Classification Level Classification E-value
Superfamily PMT central region-like 0.0562
Family PMT central region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021480   Gene: ENSMMUG00000016357   Transcript: ENSMMUT00000022967
Sequence length 604
Comment pep:known_by_projection chromosome:MMUL_1:6:134297170:134344789:1 gene:ENSMMUG00000016357 transcript:ENSMMUT00000022967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKV
MSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIY
YENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYST
SNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNA
NVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQE
VKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYCNVQIFLLLGELLESTEQYSDFYF
LACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCIKDIVGFAIMFFIIFFA
YAQLGFLIFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFF
VLLNMFLAIINDTYSEVKADYSIGRRPDFELGKMIKQSYKNVLEKFRLKKARKDEDKKTK
GSGDLAEQARREGFDENEIQKAEQMKKWKERLEKKYYSTEIQDDYQPVTQEEFREHTVTK
YKFK
Download sequence
Identical sequences ENSMMUP00000021480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]