SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021554 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021554
Domain Number 1 Region: 115-141,197-281
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000942
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021554   Gene: ENSMMUG00000016408   Transcript: ENSMMUT00000023043
Sequence length 2274
Comment pep:known_by_projection chromosome:MMUL_1:1:210056224:210155404:1 gene:ENSMMUG00000016408 transcript:ENSMMUT00000023043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERRCGSMRDLRAQVTSGLLPFPEVTLQALGEDEITLESVLRGKFAAGKNGLACLACG
PQLEVVNSVTGERLSAYRFSGVNEQPPVVLAVKEFSWQKRTGLLIGLEETEGSVLCLYDL
GISKVVKAVVLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLC
LDDLSCNQNEVEASDLEVLTGIPAEVPHIRESVMREGRHLCFQLVSPTGTAVSTLSYINR
TNQLAVGFSDGYLALWNMKSMKREYYIQLESGRVPVYAVTFQEPENDPRNCCYLWAVQST
QDSEGDVLSLHLLQLAFGNRKCLASGQILYEGLEYCEERYTLDLTGGMFPLRGQTSNTKL
LGCQSIEKFRSHGDREEGMNEALSPDTSVSVFTWQVNIYGQGKPSIYLGLFDINRWYHAQ
MPDSLRSGEYLHNCSYFALWSLESVVSRTSPHGILDILVHERSLNRGVPPSYPPPEQFFN
PSTYNFDATCLLNSGVVHLTCTGFQKETLTFLKKSGPSLNEVIPDGYNRCLVAGLLSPRF
VDIQPSSLSQEEQLEAILSAAIQTSSLGLLTGYIKRWITEEQPNSATNLRFVLEWTWNKV
VLTKEEFDRLCVPLFDGSCHFMDPQTIQSIQQCYLLLSNLNIVLSCFASEAREITERGLI
DLSNKFVVSHLICQYAQVVLWFSHSGLLPEGIDDSVQLSRLCYNYPVIQNYYTSRRQKFE
RLSRGKWNPDCLMIDGLVSQLGERIEKLWKRDEGGTGKYPPASLHAVLDMYLLDGVTEAA
KHSITIYLLLDIMYSFPNKTDTPIESFPTVFAISWGQVKLIQGLWLIDHNDFESGLDLLF
HPATAKPLSWQHSKIIQAFMSQGEHRQALRYIQTMKPTVSSGSDVILHLTVLLFNRCMVE
AWSFLRQHCNRLNIEELLKHMYEVCQEMGLMEDLLKLPFTDTEQECLVNFLQSSASVQNH
EFLLVHHLQRANYVPALKLNQTLKINVMNDRDPRLRERSLARNSILDQYGKILPRVHRKL
AVERAKPYHLSTSSVFRLVSRPKPLSAVPKQVVTGTVLTRSVFINNVLSKIGEVWASKEP
ISSTTPYNSSKIEEPSPIVYSLPAPELPEAFFGTPISKASQKISRLLDLVVQPVPQPSQC
SEFIQQCSVKSPLYLVSRSLSSSSQLKGSPQAVSRTSELHLLETPLVVKKAKSLAMSVTT
SGFSEFTPQSILRSALRSTPLASPSPSPGRSPQRLKETRISFVEEDVNSKWIPGAADDSK
LEVFTTPKKCTVPAETEWLKSKDRTTSFFLNSPEKEHQEMDVGSQSLEKLDVSKGNSSVS
ITSDETTLEYQDAPSPEDLEETVFRVCKPKSSSTALTTNVTEQTEKDGDKDAFASEVTPS
DLQKQMGHLEDAETKDLLVAAEAFSELNHLSPVQGIEASLCAPSVYEGKMFTQKSKLPVL
DEGLTSVETYTSAIRANDNKSVAGILGDSGNSSLTVSEGPIISERRLNQEVVLNLKEDDE
VEVDVLKESVNLPEEKLPISDSPPDTQEIHVIEQEKLEAQDSGEEARNLSFNELYPSGTL
KLQYNFDTIDQQFCDLADNKDTAECDIAEVDGELFVAQSNFTLILEGEEGEVEPGDFASS
DVLPKAANTATEEKLVCSGENDNHGQVADLPSAITSDQKSQKVETLPYVPEPIKVAIAEN
LLDVIKDTRSKEITSDTMEQSIHETIPLVSQNIMCPTKLVKSACKTAQETSTVTLNVSQV
DVVSSKTHTRGQRIQNVNVKSTQQEAAADVATPKMPGQSVRKKTRKPQEISEASENTYSD
VKGISENQQISQNPITPRRGRRKKEVNQDILENTSSVEQELQITTGRESKRLKSSQLLEP
AVEETIKKEVTVSSVTKRTPRRIKRSVESQESVEIINDLKVSNVTSPSRMIRKLRSANLD
ASENIGNKPDDKSSDEQLPIKRIRRVRGREVSPSDVREDSNLDSSQLSLQAELDMSAIPR
KRGRPRKIHPSEDVGSKAVKEEGSPKKKEAPSIKRRSTRSTAAKSENTDVGKPASGKSIL
VPNKELSMVMSSKKKLTKKTENQSQKGSLQSVSEERTDEMTHKETNDREERLLATASFTK
SSRSTRTRSSKAILLPDLSEPNSEPLFSPVSEVPRKAKAKKIEVPAQLKELVSDLSSQFV
ISPPTLRSRQKNTSNKNKLEDELKDDAQSVETVGKPKAKRIRTSKTKQASKNTEKESAWS
PPPIEIRLISPLASPVDRVKSKPRKTTEVTGTGRGRSRKKLSSYPKQILRRKML
Download sequence
Identical sequences F7FYF6
ENSMMUP00000021554 XP_001088135.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]