SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021573 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021573
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 9.55e-47
Family Peptidyl-tRNA hydrolase-like 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021573   Gene: ENSMMUG00000016424   Transcript: ENSMMUT00000023062
Sequence length 214
Comment pep:known chromosome:MMUL_1:15:98858305:98869865:1 gene:ENSMMUG00000016424 transcript:ENSMMUT00000023062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRGFLGAGQWLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPTHPEAVQAHVLGCF
SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Download sequence
Identical sequences A0A2K5NSU1 A0A2K5TV85 F7FKW9
9544.ENSMMUP00000021573 ENSMMUP00000021573 ENSMMUP00000021573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]