SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021614 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021614
Domain Number 1 Region: 10-367
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.68e-92
Family Extradiol dioxygenases 0.000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021614   Gene: ENSMMUG00000016454   Transcript: ENSMMUT00000023105
Sequence length 392
Comment pep:known_by_projection chromosome:MMUL_1:11:122925850:122948971:-1 gene:ENSMMUG00000016454 transcript:ENSMMUT00000023105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHV
IKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKAREQGAKIVREP
WVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYTGQFLPGYEAPVFMDPLLPKLPKCSLEII
DHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPIN
EPAPGKKKSQIQEYVDYNGGAGVQHIALNTQDIITAIRHLRERGMEFLSVPSTYYKQLRE
KLKTAKIKVKENIDVLEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFGA
GNFNSLFKAFEEEQNLRGNLTDLETNGVVPGM
Download sequence
Identical sequences 9544.ENSMMUP00000021614 ENSMMUP00000021614 ENSMMUP00000021614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]