SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021747 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021747
Domain Number 1 Region: 513-706
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-58
Family Hemopexin-like domain 0.00000000654
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.87e-33
Family Matrix metalloproteases, catalytic domain 0.000000606
Further Details:      
 
Domain Number 3 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-21
Family Fibronectin type II module 0.0000981
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-21
Family Fibronectin type II module 0.000075
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-20
Family Fibronectin type II module 0.0000923
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-18
Family MMP N-terminal domain 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021747   Gene: ENSMMUG00000016549   Transcript: ENSMMUT00000023244
Sequence length 707
Comment pep:known chromosome:MMUL_1:10:18469745:18477555:-1 gene:ENSMMUG00000016549 transcript:ENSMMUT00000023244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLALLVLGCCCAAPRQRQSTLVLFPGDLKTNLTDRQLAEDYLYRYGYTRVAEM
HGDSKSLGPALLLLQKQLSLPQTGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIEDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTKFGNADGAACHFPFTFEGRS
YSACTTDGRSDGVPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVIGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMY
PMYRFTEEPPLHKDDVNGIQYLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSDR
PTAGPTGPPSAGPTGPPTAGPSTTTTVPLNPVDDACNVNIFDAITEIGNQLYLFKDGRYW
RFSERRGSRLQGPFLIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRRGAGKMLLFSGRRFWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYQEKAYFCQDRFYWRVSFQSGVNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences F6W5A7
ENSMMUP00000021747 ENSMMUP00000021747 9544.ENSMMUP00000021747 NP_001253834.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]