SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021784 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021784
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-33
Family C-type lectin domain 0.000000648
Further Details:      
 
Domain Number 2 Region: 242-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 302-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000129
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 428-497
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 366-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 488-549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021784   Gene: ENSMMUG00000016580   Transcript: ENSMMUT00000023283
Sequence length 610
Comment pep:known_by_projection chromosome:MMUL_1:1:199432366:199440202:-1 gene:ENSMMUG00000016580 transcript:ENSMMUT00000023283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNC
TALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSAPIPACKVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVP
VCEAFQCTALSNPERGYMNCLPSPSGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVTCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHW
SGMLPTCEAPTESNTPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAKKFVPASSCQSLESD
GSYQKPSYIL
Download sequence
Identical sequences A0A1D5QPQ4
9544.ENSMMUP00000021784 ENSMMUP00000021784 XP_001094967.1.72884 ENSMMUP00000021784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]