SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021787 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021787
Domain Number 1 Region: 363-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.91e-111
Family Transferrin 0.00000058
Further Details:      
 
Domain Number 2 Region: 22-349
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-100
Family Transferrin 0.000000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021787   Gene: ENSMMUG00000016584   Transcript: ENSMMUT00000023286
Sequence length 711
Comment pep:known_by_projection chromosome:MMUL_1:2:188394761:188421013:1 gene:ENSMMUG00000016584 transcript:ENSMMUT00000023286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPSRALWLLLALRTVLGGMEVRWCVTSDSEQQKCSNMSTAFREAGIQPSLLCVQGTSP
DHCIQLIAPERSDPALPGPADRISRVSPAMRPTPAGPRPGEVGTSYYAVAVVKRSSQVTI
NTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETRY
SESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLVEGAGDVAFVKHSTVLENTDGKTL
PSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQR
LFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGQEYLHAMKGLLCDPNR
LPPYLRWCVLSTPEIQKCGDMAVAFGRQQLKPEIQCVSAKSPQHCMEQIQAGQIDTVTLS
GEDIYTAGKTYGLAPAAGEGYASEDSSNSYFVVAVVRRDSSHAFTLDELRGKRSCHAGFG
SPAGWDIPVGALIRRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQG
RNKCVGNSQEQYYGNSGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYEL
LCPNGARAEVSQFAACNLAQMPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMF
DSSNYHGQDLLFKDATVRAVPVGEKTTYRDWLGLDYVAALEGMLSQQCSGA
Download sequence
Identical sequences ENSMMUP00000021787 ENSMMUP00000021787 9544.ENSMMUP00000021787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]