SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021874
Domain Number 1 Region: 53-128
Classification Level Classification E-value
Superfamily PUA domain-like 3.31e-27
Family PUA domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.4e-22
Family Nip7p homolog, N-terminal domain 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021874   Gene: ENSMMUG00000016635   Transcript: ENSMMUT00000023378
Sequence length 138
Comment pep:novel chromosome:MMUL_1:20:67716703:67718304:1 gene:ENSMMUG00000016635 transcript:ENSMMUT00000023378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPG
AEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIV
VFHQADVGEYVRHEETLT
Download sequence
Identical sequences ENSMMUP00000021874 9544.ENSMMUP00000021874 ENSMMUP00000021874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]