SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021875 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021875
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.24e-22
Family Nip7p homolog, N-terminal domain 0.0000583
Further Details:      
 
Domain Number 2 Region: 50-81
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000303
Family PUA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021875   Gene: ENSMMUG00000016635   Transcript: ENSMMUT00000023379
Sequence length 91
Comment pep:novel chromosome:MMUL_1:20:67716703:67718304:1 gene:ENSMMUG00000016635 transcript:ENSMMUT00000023379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKGFGVAAKS
TQDCRKVDPMAIVVFHQADVGEYVRHEETLT
Download sequence
Identical sequences ENSMMUP00000021875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]