SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021906 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021906
Domain Number 1 Region: 38-144
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 309-411
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 418-534
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 4 Region: 185-257
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000471
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021906   Gene: ENSMMUG00000016658   Transcript: ENSMMUT00000023411
Sequence length 756
Comment pep:known_by_projection chromosome:MMUL_1:8:23403122:23471605:-1 gene:ENSMMUG00000016658 transcript:ENSMMUT00000023411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEGRVEVYYDG
QWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAAC
TSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIEHNLNIQVEDIRIRAILSAYRK
RTPVTEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKAIEPGRGRS
WPLEVPCVQLERRLSALSLSFQMESTTQQSPPAGPVAAPILPGRRPQPLQSASLFLKGQS
HGNPDGQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAV
TGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKLR
LNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWH
GDVYANKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEM
VQQTTYLEDRPMFMLQCAMEENCLSASAAQTNPTTGYRRLLRFSSQIHNNGQSDFRPKNG
RHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANF
GDQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRY
DGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLS
Download sequence
Identical sequences ENSMMUP00000021906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]