SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021925 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021925
Domain Number 1 Region: 233-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-72
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 128-225
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 3 Region: 3-62
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000296
Family SH3-domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021925   Gene: ENSMMUG00000016672   Transcript: ENSMMUT00000023431
Sequence length 544
Comment pep:novel chromosome:MMUL_1:2:44674409:44723452:1 gene:ENSMMUG00000016672 transcript:ENSMMUT00000023431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAP
LTKATAAESSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGSRKPKDILGNKVSVKILNP
NFIQEVAPEFLVPLVDVTCLLGDTVVLQCKVCGRPKPTITWKGPDQNILDTDNSSATYTV
SSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQDAAADGATISWKENFDS
AYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYIT
LHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHL
DIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTD
IWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQED
FRRRPTAATCLQHPWLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRV
NQGT
Download sequence
Identical sequences ENSMMUP00000021925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]