SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021930 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021930
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5e-51
Family Phosphate binding protein-like 0.0000348
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.89e-24
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021930   Gene: ENSMMUG00000016675   Transcript: ENSMMUT00000023436
Sequence length 1115
Comment pep:known_by_projection chromosome:MMUL_1:15:34473611:34639399:1 gene:ENSMMUG00000016675 transcript:ENSMMUT00000023436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAPDGSRAGAQRDEPEPGTRRSPAPSSGARWLGSTLHGRGPPGSRKPGEGTGAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIISSENNFFIWNLQHDPMGKPMWMR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDASTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRALNTSFVEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLS
HDNRRKYMFSDEEGQNQLGIRIHQDIPLPPRRKELPASLTTNGKADSLNVSRNSVMQELS
ELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES
Download sequence
Identical sequences F6VTB5 G7PRT2
ENSMMUP00000021930 9544.ENSMMUP00000021930 ENSMMUP00000021930 XP_005581215.1.63531 XP_014972676.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]