SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021935 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021935
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily ALDH-like 4.58e-63
Family ALDH-like 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021935   Gene: ENSMMUG00000016682   Transcript: ENSMMUT00000023442
Sequence length 228
Comment pep:novel chromosome:MMUL_1:6:122937799:122989593:-1 gene:ENSMMUG00000016682 transcript:ENSMMUT00000023442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLVVPSALFAAVGTAGQRCTTARRLFVHESIHDEVVNRLKKAYAQIRVGNPWDSNVLYGP
LHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDASIAHTETFAP
ILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAE
IGGAFGGEKHTGGGRESGSDAWKHYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences ENSMMUP00000021935 9544.ENSMMUP00000021935 ENSMMUP00000021935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]