SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021976 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021976
Domain Number 1 Region: 741-845
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.47e-28
Family Lipoxigenase N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 31-138
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000773
Family C-type lectin domain 0.011
Further Details:      
 
Domain Number 3 Region: 1454-1512,1550-1672
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000011
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021976   Gene: ENSMMUG00000016717   Transcript: ENSMMUT00000023488
Sequence length 1726
Comment pep:known_by_projection chromosome:MMUL_1:20:70635011:70721950:1 gene:ENSMMUG00000016717 transcript:ENSMMUT00000023488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFKGGSWLWLYIRTSIILGSKLNSPGPHGQNNCYQFNRFHCSFEEAENYCHGQRGFLAH
IWNQEVEDLIRDFLEEREKWWIGQNVMPLRKHQGENYPADVAAHGAPKPPSCTYLSRNLN
RILSKEDKCFLRHYFICQTDGVLDRDAHYERNGNDSHLYERPEKTKRGVGIARDKMPPGP
GALSATCHHPLPAHLGLTLSPRLDNFPASASQAGLKILTSSNPPASASQTTISKLTNSRS
VAQAGQSLSKLSFSRSNGSRNKFCPLTEKLLKVITVIDEIAGNFSRAVHGLQAHNKLQEA
CEFLQKLTALTPRFFKPAQVNLINSLIYLSEELLRIPFLNSSSLDFKVPATVCPFHSFNN
VTKAGEGSWLESKSDTEQVEDILEMSLAELGNIGKAFLEQDQSAESSVTLTSSVATLLLS
RQNTSTLPLSSYTLGHPAPVRLGFPSALALKELLNQHPGVNVQVSVKLIRPLKSDPLNVV
GSIGSVLLSANRKLLQVHDLVEDIEIMLWRNVSMETHPTSFNMSTDQLTITVNITSLEKS
LIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLTPEHLQHGIG
TYCIRAVLSESQKGAQQTPSLVSVITAVTQCYYWESHNQTWSSNGCQVGPQSTILRTQCL
CNHLTFFASDFFVVPRTVNVEDTVELFLRMTNNPVGVSLLAGLLGFYVITVVWAWKKDQA
DMQKVKVTVLADNDPSAQFHYLIQVYTGYRRRAATTAKVVITLYGSEGRSEPHHLCDPQK
TVFERGGLDVFLLTTRSSLGDLHSLRLWHDNSGISPSWYVSQVIVCDMAVKRKWHFLCNC
WLAVDLGDCELDRVFIPVSKRQLFSFRHLFSSMIVEKFTQDYLWLSVATRHPWNQFTRVQ
RLSCCMTLLLCNMVISVMFWKINSTTAKRDEQLGPFAVAWSELLISIHTAVILFPINVVI
GRLFPLIEPQETLPLFPPVQASCLSDASAEPLSATMVVEELKETVRFLLRRNTYLLSKCE
QPPWSSCDVTKLVKLLSSLISSHLEGQSCHQQAERHWARVVPENHHHFCRYLRRALQRLQ
SHLGTLGLARGHQPCDFLDAASQLQTLQQLLETHILPMEQEPSREVTSFAILSSEEGKKP
ISNGLSRWLTAVCWLLLGLTSLASAFFTALYSLEMSKDQATSWMISIILSVLQNVFISQP
GKVVFFTFLHSLMMSRMPQLNKEKEQQTKRILALLAKCSSSVPGSRDKNNPVYVAPAMNS
PTKRPERTLKKKKLFKLTGDILVQILFLTLLMTAICSVKNSNRFYLHQAIRKTFSPRFSE
IKLLQDFYPWANHILLPSLYGDYRGKNAVLKPIHCKYGVQFIFQIPCTTIYEKVEEGQLV
FSDGRTCGHPKSLFPGLHLRRFSYICSPRPMGPIPDELHKRLTSKNDSGFSYIMRSAFFT
SVRLESFTSLQMSKKGFAWSIISQVIYYLLVCYSAFKLGCRLKRQKWRFFTGRRNILDTS
IILISFIILGLDMKSISLLRKNMARYHDDQDRFISFREAVKVNSAATHLVGFLVLLATVQ
LWNLLRHSPRLRVISRTLSRAWDEVVGFLLIILILLTGYAVAFNLLFGCSISDYRTFFSS
AVTVVGLLIGISHQEEVIDLDPVLGTFLILTSVILMVLVVINLFVSAILMAFGKERKSLK
KEVALIDSLLQKLSNLLGISRPQKTSSEQAATTAMGTDTEVLDELP
Download sequence
Identical sequences ENSMMUP00000021976 ENSMMUP00000021976 9544.ENSMMUP00000021976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]