SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022004 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022004
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000289
Family TAP-C domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022004   Gene: ENSMMUG00000016740   Transcript: ENSMMUT00000023519
Sequence length 185
Comment pep:known chromosome:MMUL_1:17:93572132:93592102:-1 gene:ENSMMUG00000016740 transcript:ENSMMUT00000023519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSFHRESMRNTVD
KKKLEQLYGRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKE
FLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLGSPPFLNV
RALHH
Download sequence
Identical sequences ENSMMUP00000022004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]