SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022064 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022064
Domain Number 1 Region: 24-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.08e-56
Family MHC antigen-recognition domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-21
Family C1 set domains (antibody constant domain-like) 0.0000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022064   Gene: ENSMMUG00000016783   Transcript: ENSMMUT00000023581
Sequence length 333
Comment pep:known chromosome:MMUL_1:1:136896890:136900191:-1 gene:ENSMMUG00000016783 transcript:ENSMMUT00000023581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPFQLLAVLFPGGDSERAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAILLKPWSKGNFSDKEFAELEEIFRVYIFGFAQEVQDFAGDFQIQYPFEIQGIAGC
ELHSGGAIVSFLRGALRGLDFLSVKNASCVPSPEGGSKAQKVCALIMQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMQ
DEQEQRGTQLGDILPNANWTWYLRATLDVAAGEAAGLSCRVKHSSLQGQDIVLYWRNPTS
TGSIVLAIMVPSLLLLLCLALWYMRRRSYQNIP
Download sequence
Identical sequences F7D531
ENSMMUP00000022064 ENSMMUP00000020091 9544.ENSMMUP00000022064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]